General Information

  • ID:  hor005596
  • Uniprot ID:  O42471
  • Protein name:  GnRH-associated peptide IIB
  • Gene name:  gnrh2b
  • Organism:  Carassius auratus (Goldfish)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Olfactory bulbs, hypothalamus and telencephalon, midbrain and posterior brain areas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  EIDVYDPSEVSEEIKLCNAGKCSFLIPQGRNILKTILLDALTRDFQKRK
  • Length:  49
  • Propeptide:  MVHICRLFVVMGMLMFLSVQFASSQHWSHGWYPGGKREIDVYDPSEVSEEIKLCNAGKCSFLIPQGRNILKTILLDALTRDFQKRK
  • Signal peptide:  MVHICRLFVVMGMLMFLSVQFASS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O42241-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005596_AF2.pdbhor005596_ESM.pdb

Physical Information

Mass: 646587 Formula: C248H409N67O76S2
Absent amino acids: HMW Common amino acids: L
pI: 6.49 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 17
Hydrophobicity: -33.06 Boman Index: -9825
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 103.47
Instability Index: 6026.94 Extinction Coefficient cystines: 1615
Absorbance 280nm: 33.65

Literature

  • PubMed ID:  9289408
  • Title:  Cloning and expression pattern of a second [His5Trp7Tyr8]gonadotropin-releasing hormone (chicken GnRH-H-II) mRNA in goldfish: evidence for two distinct genes.